Biochemistry Answers

Questions: 1 443

Answers by our Experts: 1 328

Need a fast expert's response?

Submit order

and get a quick answer at the best price

for any assignment or question with DETAILED EXPLANATIONS!

Search & Filtering

a) Describe the isoelectric point. With the help of an example explain the utility of this
property of amino acids and how it is useful in maintaining pH in human systems.
b) What are the functional roles of tRNA and rRNA? Explain how these are structurally
different and where are these RNAs found in cell?
a) Define disaccharides. Write structures for disaccharides in which glucose units are linked
together in the following ways.
i)  - 1,4 ii)  - 1,4 iii)  - 1,6 iv)  - 1,6
3) Draw the complete structures of the following amino acid or oligopeptide.
a. The dipeptide Ala-His
b. The tripeptide Glu-Pro-Cys
4) Re-write the following peptides using the three letter amino acid codes. a. HEWATRGIR
b. QYKVLMCD
5) Draw the predominate form(s) of histidine at the following pH values. a. pH 3.0
b. pH 8.0 c. pH 10.0
6) Indicate whether and where the following peptides are cleaved by the indicated treatments.
Peptide
a. Phe-Arg-Pro b. Phe-Met-Leu c. Ala-Gly-Phe d. Gly-Met-Pro e. Pro-Arg-Met
Treatment
trypsin carboxypeptidase B chymotrypsin CNBr
trypsin
7) Consider the peptide: YHFDMPTKQERGNPCVDRPIASMVLIMEALIKYAGAELICSHWNWDEA a. If it is cleaved with trypsin, what are the sequences of the fragments?
b. If it is cleaved with pepsin, what are the sequences of the fragments?
How is the enzyme pyruvate dehydrogenase complex different from other enzymes? Explain how it functions in the conversion of pyruvate to acetyl-CoA
Draw and name the structures of the nucleotides and nucleocides of both the DNA and RNA.
Describe the isoelectric point.With the help of an example explain the utility of this property of amino acids and how it is useful in maintaining pH in human systems.
What are the functional roles of tRNA and rRNA?Explain how these are structurally different and where are these RNAs found in cell?
What are the various types of specificities exhibited by enzymes?Illustrate your answer with an example for each.
What are the similarities with respect to composition in the four DNA nucleotides?