Answer to Question #86784 in Biochemistry for Ayce Yilmaz

Question #86784
3) Draw the complete structures of the following amino acid or oligopeptide.
a. The dipeptide Ala-His
b. The tripeptide Glu-Pro-Cys
4) Re-write the following peptides using the three letter amino acid codes. a. HEWATRGIR
b. QYKVLMCD
5) Draw the predominate form(s) of histidine at the following pH values. a. pH 3.0
b. pH 8.0 c. pH 10.0
6) Indicate whether and where the following peptides are cleaved by the indicated treatments.
Peptide
a. Phe-Arg-Pro b. Phe-Met-Leu c. Ala-Gly-Phe d. Gly-Met-Pro e. Pro-Arg-Met
Treatment
trypsin carboxypeptidase B chymotrypsin CNBr
trypsin
7) Consider the peptide: YHFDMPTKQERGNPCVDRPIASMVLIMEALIKYAGAELICSHWNWDEA a. If it is cleaved with trypsin, what are the sequences of the fragments?
b. If it is cleaved with pepsin, what are the sequences of the fragments?
1
Expert's answer
2019-03-22T02:16:50-0400
Dear Ayce Yilmaz, your question requires a lot of work, which neither of our experts is ready to perform for free. We advise you to convert it to a fully qualified order and we will try to help you. Please click the link below to proceed: Submit order

Need a fast expert's response?

Submit order

and get a quick answer at the best price

for any assignment or question with DETAILED EXPLANATIONS!

Comments

No comments. Be the first!

Leave a comment